DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCA8

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001275914.1 Gene:ABCA8 / 10351 HGNCID:38 Length:1621 Species:Homo sapiens


Alignment Length:371 Identity:93/371 - (25%)
Similarity:158/371 - (42%) Gaps:77/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TANSDLDLAARRRLFISQPSTLATRRQQAVCVRR--AHKMYG--SSKNPNVVLDGLNMTVPKGSI 79
            |||     |.....|..:|..:|:      |:|:  |.|..|  |.:...:....::..|.||.:
Human  1265 TAN-----ALNSTNFDEKPVIIAS------CLRKEYAGKRKGCFSKRKNKIATRNVSFCVRKGEV 1318

  Fly    80 YGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVPGPRIGYMPQEIALYGEFTMRE 144
            .||||.:|.||:|.:..|.|..:..:|::.:.|.     |.|.....:||.|||.||:...|:|:
Human  1319 LGLLGHNGAGKSTSIKVITGDTKPTAGQVLLKGS-----GGGDALEFLGYCPQENALWPNLTVRQ 1378

  Fly   145 TLIYFGIISAMSKGDIEDRTEFLLKLLNLPNASKF-VKNLSGGQQRRVSLAVALLHEPELLILDE 208
            .|..:..:..:.|||.|.....|:..|.|.:..|. ||.||.|.:|::...:::|..|.:::|||
Human  1379 HLEVYAAVKGLRKGDAEVAITRLVDALKLQDQLKSPVKTLSEGIKRKLCFVLSILGNPSVVLLDE 1443

  Fly   209 PTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGKMLAEESPDYLRQQ 272
            |:.|:||..:|.:|..:....:|.....::||||:.|. |....:.::..|::....|..:|:.:
Human  1444 PSTGMDPEGQQQMWQAIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLRCIGSIQHLKSK 1508

  Fly   273 YNADSL-----------------------------------------EDV------FLKLSVLQN 290
            :..|.|                                         |||      |.||..::.
Human  1509 FGKDYLLEMKVKNLAQVEPLHAEILRLFPQAARQERYSSLMVYKLPVEDVQPLAQAFFKLEKVKQ 1573

  Fly   291 MGKRRRSSIAQEIVEQVTVPAISNPALDMSDEQHAAEISGEFGDNI 336
            .......|::|..:|||        .|::|.||...:...:|..::
Human  1574 SFDLEEYSLSQSTLEQV--------FLELSKEQELGDFEEDFDPSV 1611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 67/227 (30%)
CcmA 54..321 CDD:224054 79/317 (25%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCA8NP_001275914.1 rim_protein <235..>790 CDD:130324
ABC_subfamily_A 480..703 CDD:213230
rim_protein <1033..1598 CDD:130324 90/356 (25%)
ABC_subfamily_A 1285..1506 CDD:213230 66/225 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.