DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and abcg1

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:XP_002942182.2 Gene:abcg1 / 100496811 XenbaseID:XB-GENE-996335 Length:664 Species:Xenopus tropicalis


Alignment Length:389 Identity:91/389 - (23%)
Similarity:161/389 - (41%) Gaps:81/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KNPNVVLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLN-SGEIWVLGGRPGSRGSGVPG 124
            |....:|.|::.....|.:..::|.||.||:||::.:.|.|... .||: ::.|:|....|   .
 Frog    94 KGYKTLLKGISGKFHCGELAAIMGPSGAGKSTLMNILAGYRETGMKGEV-LINGQPRDLRS---F 154

  Fly   125 PRIG-YMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLN----LPNASKFVKNLS 184
            .::. |:.|:..|....|::|.::....:....|.  |.|.|.:.::|.    ||.|.....:||
 Frog   155 RKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKD--EGRKEMVKEILTALGLLPCADTRTGSLS 217

  Fly   185 GGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKN---GHTTVIITTHYIDEC 246
            |||::|:::|:.|::.|.::..||||.|:|    .|....:|.:.|:   |...:|.|.|     
 Frog   218 GGQRKRLAIALELVNNPPVMFFDEPTSGLD----SSSCFQVVSLMKSLAQGGRNIICTIH----- 273

  Fly   247 AQAHMIGLLRGGKMLAEESPDYLRQQYNADSLEDVFLKLSVLQNMGKRRRSSIAQEI----VEQV 307
                                     |.:| .|.::|.:|.||.......|..::..:    |..:
 Frog   274 -------------------------QPSA-KLFELFDQLYVLSQGQCIYRGKVSNLVPYLRVLGL 312

  Fly   308 TVPAISNPALDMSDEQHAAEI-SGEFGD-NISMSSAARDPISTTAP--------AAPPL----PP 358
            ..|...|||      ....|: |||:|| |..:..|.:|.:....|        ...||    |.
 Frog   313 NCPTYHNPA------DFIMEVASGEYGDQNPHLVRAVQDNLCEVEPKRDLCGENEQSPLMWHRPD 371

  Fly   359 PQEIPTSFWYNLHVMQSHHLHALIWKNFLWMMRNVGVMLFI-----VGLPVVQILLFCYAIGHD 417
            ....||...::...........|..:.|:.:||: .|:..:     :|:.::..||: ..||::
 Frog   372 EDPSPTEGCHSFSASCLTQFCILFKRTFINIMRD-SVLTHLRITSHIGIGILIGLLY-LGIGNE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 53/217 (24%)
CcmA 54..321 CDD:224054 66/272 (24%)
ABC2_membrane_3 394..770 CDD:289468 6/29 (21%)
ABC2_membrane <581..738 CDD:279410
abcg1XP_002942182.2 3a01204 59..664 CDD:273361 91/389 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.