DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PPM1F

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens


Alignment Length:266 Identity:76/266 - (28%)
Similarity:129/266 - (48%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VSSMQGWRLEMEDSH------SAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESES 88
            :.:::..|.:|||.|      :....|.|| ...:||||||||.|...:.:.|.|:.:.......
Human   159 IHAIRNTRRKMEDRHVSLPSFNQLFGLSDP-VNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPE 222

  Fly    89 FSKHKYEAGIREGFLQLDE-DMRKLYHDQ-QGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAV 151
            ..... |..:||.|.:.|: .:||...:: |.|:|.:|..::...:::...|||:.::.:.|..|
Human   223 LPTDP-EGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVV 286

  Fly   152 ISTIDHKPFSPKEQERIQNAGGSVM---IKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPD 213
            .....|:|....|:.||:..||.|.   ..|:|||||||||.||...|         ..||.|.|
Human   287 KLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQK---------PYVSGEAD 342

  Fly   214 IIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPM-IVNSVLDICLHKGSRDNMT 277
            ......:..::::::||||.:||:...||...::|.|.......: :...::.....:||.||:|
Human   343 AASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNIT 407

  Fly   278 LLLLLL 283
            ::::.|
Human   408 VMVVFL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 74/258 (29%)
PP2C_C 284..352 CDD:285117 76/266 (29%)
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 73/257 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.