DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PTC2

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_011013.1 Gene:PTC2 / 856823 SGDID:S000000891 Length:464 Species:Saccharomyces cerevisiae


Alignment Length:303 Identity:99/303 - (32%)
Similarity:159/303 - (52%) Gaps:35/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRL-----KDPFATWSYFAVFD 64
            ||..|..|..:|::..|..:...:.:.:|||||:.|||||.....:     ||..|   ::.:||
Yeast     1 MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIA---FYGIFD 62

  Fly    65 GHAGSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDMRKLYHD-----QQGGSTAIC 124
            ||.|::::.:|...::..:.|.:||.:......:.:.|:..|.   ||..|     ...|.||..
Yeast    63 GHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRALIDTFINTDV---KLLQDPVMKEDHSGCTATS 124

  Fly   125 VFVSPDKIYLV--NCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVS 187
            :.||..:..||  |.||||.|::.:|.|...:.||||....|:.||..|.|.|.:.|:||.||:|
Yeast   125 ILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMDRVNGNLALS 189

  Fly   188 RAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEH------DEFIVVACDGIWDVMTSSEVCEFI 246
            ||.||::||::....|.:|:|:..|||:     ||      |||:::|||||||.:||.:..:.:
Yeast   190 RAIGDFEFKSNPKLGPEEQIVTCVPDIL-----EHSLDYDRDEFVILACDGIWDCLTSQDCVDLV 249

  Fly   247 RSRLLVTYDLPMIVNSVLDICLHKGSR------DNMTLLLLLL 283
            ...|.....|..|.:.::|:|....:.      |||:::::.|
Yeast   250 HLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVAL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 91/273 (33%)
PP2C_C 284..352 CDD:285117 99/303 (33%)
PTC2NP_011013.1 PP2C 23..279 CDD:395385 89/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X444
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.