DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PTC4

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_009683.1 Gene:PTC4 / 852422 SGDID:S000000329 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:373 Identity:110/373 - (29%)
Similarity:170/373 - (45%) Gaps:99/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGGFLEKPETEK----------QAQEGHGNGLRYCVSSMQGWRLEMEDSH-------SAACRLKD 52
            ||..|..|.|||          ||..|.......||.||||:||..||:|       ....|..:
Yeast     1 MGQLLSHPLTEKTIEYNEYKNNQASTGIVPRFYNCVGSMQGYRLTQEDAHLIRNENSVVYVRFFN 65

  Fly    53 PF------ATWSYFAVFDGHAGSQIS--LHCAEH-----------------LMSTILESESFSKH 92
            ||      .:.:.|||||||.|...|  |....|                 |:..|  :.||..|
Yeast    66 PFIDKYETLSLNVFAVFDGHGGDDCSKFLSGGRHHRDGNGSSNGNGEPNAGLIKWI--AYSFENH 128

  Fly    93 KYEA-----------------GI-----REGFLQLDEDMRKLYHDQQGGSTAI--CVFVSPDKIY 133
            .|.:                 |:     ::.|:..||::.:.:.:...||||:  |: ::.:.:|
Yeast   129 HYTSTTNNDSSKFKRSFNTLEGLVSQIFKDAFILQDEELYRHFANSSCGSTAVVACI-INEESLY 192

  Fly   134 LVNCGDSRAVIS--RNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFK 196
            :.||||||.::|  .||...:| .||||....|..||.:.||:|.:.|:.|.||:||||.|:.||
Yeast   193 VANCGDSRCILSSKSNGIKTMS-FDHKPQHIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFK 256

  Fly   197 NDGS------------------KSPVDQMVSPEPDIIVCNRSEH--DEFIVVACDGIWDVMTSSE 241
            ...:                  ..|.:..|:.|||::: ::.::  |||:|:|||||||:..:.:
Yeast   257 RGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLM-HKIDYSKDEFLVLACDGIWDIYNNKQ 320

  Fly   242 VCEFIRSRLLVTYDLPMIVNSVLDICLHKGSR------DNMTLLLLLL 283
            :..||:..|:....|..|:..:||..:.:.:.      ||||.::::|
Yeast   321 LIHFIKYHLVSGTKLDTIITKLLDHGIAQANSNTGVGFDNMTAIIVVL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 97/333 (29%)
PP2C_C 284..352 CDD:285117 110/373 (29%)
PTC4NP_009683.1 PP2C 82..355 CDD:395385 78/277 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.