DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PTC3

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_009497.2 Gene:PTC3 / 852224 SGDID:S000000152 Length:468 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:110/339 - (32%)
Similarity:173/339 - (51%) Gaps:30/339 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRL--KDPFATWSYFAVFDGHA 67
            ||..|..|..:|:...|......:.:.:|||||:.|||:|.....|  :......:::.:||||.
Yeast     1 MGQILSNPIIDKEHHSGTDCLTAFGLCAMQGWRMSMEDAHIVEPNLLAESDEEHLAFYGIFDGHG 65

  Fly    68 GSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDMRK--LYHDQQGGSTAICVFVSPD 130
            ||.::..|...::|.:.:.|||.....|..:.:.||..|.::.|  ...|...|.||..:.||..
Yeast    66 GSSVAEFCGSKMISILKKQESFKSGMLEQCLIDTFLATDVELLKDEKLKDDHSGCTATVILVSQL 130

  Fly   131 KIYLV--NCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDY 193
            |..|:  |.||||.|:|..|.:...:.||||....|:.||..|.|.|.:.|:||.||:|||.||:
Yeast   131 KKLLICANSGDSRTVLSTGGNSKAMSFDHKPTLLSEKSRIVAADGFVEMDRVNGNLALSRAIGDF 195

  Fly   194 DFKNDGSKSPVDQMVSPEPDIIVCNRS-EHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLP 257
            :||::....|.:|:|:..||||..|.: :.|||:::|||||||.:||.|..:      ||.|.:.
Yeast   196 EFKSNTKLGPHEQVVTCVPDIICHNLNYDEDEFVILACDGIWDCLTSQECVD------LVHYGIS 254

  Fly   258 M-------IVNSVLDICLH---KGSR---DNMTLLLLLLPGAPKVDMDAVKAERS----LDQTIV 305
            .       |.:.::|:|..   :||.   |||::.::.|....:.:....:..||    :..:.|
Yeast   255 QGNMTLSDISSRIVDVCCSPTTEGSGIGCDNMSISIVALLKENESESQWFERMRSKNYNIQTSFV 319

  Fly   306 QITKEVIEKHEIHD 319
            |..|.:.:.|:..|
Yeast   320 QRRKSIFDFHDFSD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 95/269 (35%)
PP2C_C 284..352 CDD:285117 7/40 (18%)
PTC3NP_009497.2 PP2C 23..280 CDD:395385 92/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2423
OMA 1 1.010 - - QHG53745
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X444
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.