DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PTC1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_010278.3 Gene:PTC1 / 851558 SGDID:S000002164 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:100/309 - (32%)
Similarity:146/309 - (47%) Gaps:69/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEKPETEKQAQEGHGNGLRYCVSSMQG----WRLEMEDSH----SAACRLKDPFATWSYFAVFDG 65
            ||:|||...        :.|.|...:.    :|..|||.|    :.|.||     .|.|||||||
Yeast     8 LERPETPYD--------ITYRVGVAENKNSKFRRTMEDVHTYVKNFASRL-----DWGYFAVFDG 59

  Fly    66 HAGSQISLHCAEHLMSTILESESFSKHKYEAG--IREGFLQLDEDMRKLYHDQQGGSTAICVF-- 126
            |||.|.|..|.:|| .||:|....:....:..  :.:.||.:||::........|.:.|:||.  
Yeast    60 HAGIQASKWCGKHL-HTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRW 123

  Fly   127 -----VSPD---------KIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMI 177
                 ||.|         |:|..|.||||.|:.|||.::..|.|||.....|.:|::.|||.:|.
Yeast   124 ELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMK 188

  Fly   178 KRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEV 242
            .|:||.|||:|:.||..|         |.:|...|.......:..|:|:::||||:|||:...:.
Yeast   189 SRVNGMLAVTRSLGDKFF---------DSLVVGSPFTTSVEITSEDKFLILACDGLWDVIDDQDA 244

  Fly   243 CEFIR--------SRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLL 283
            ||.|:        :::||.|            .|..|:.||:|::::.|
Yeast   245 CELIKDITEPNEAAKVLVRY------------ALENGTTDNVTVMVVFL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 93/283 (33%)
PP2C_C 284..352 CDD:285117 100/309 (32%)
PTC1NP_010278.3 PP2Cc 12..279 CDD:214625 96/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.