DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and HAB1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001185385.1 Gene:HAB1 / 843609 AraportID:AT1G72770 Length:511 Species:Arabidopsis thaliana


Alignment Length:322 Identity:95/322 - (29%)
Similarity:144/322 - (44%) Gaps:74/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SMQGWRLEMEDSHSAACR-LKDPF----------------ATWSYFAVFDGHAGSQISLHCAEHL 79
            |:||.|.||||:.:.:.. ||.|.                .|..:|.|:|||.|.:::.:|.:.|
plant   194 SIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRL 258

  Fly    80 MSTILES-ESFSKHKYEAGIREG------------FLQLDEDMR---------------KLYHDQ 116
            ...:.|. |.......:....||            ||.:|.::.               :....:
plant   259 HFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASE 323

  Fly   117 QGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMI---K 178
            ..||||:...|....|.:.||||||||:.|...|:..::||||....|..||:||||.|:.   .
plant   324 TVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGA 388

  Fly   179 RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVC 243
            |:.|.||:||:.||...|         ..|.|||::....||..||.:::|.||:||||.:.|||
plant   389 RVFGVLAMSRSIGDRYLK---------PYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVC 444

  Fly   244 EFIRSRLLVTY-------------DLPMIVNSVLD----ICLHKGSRDNMTLLLLLLPGAPK 288
            |..|.|:|:.:             .:.....:..|    :.|.|||:||::::::.|....|
plant   445 EIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVI
DLKAQRK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 93/309 (30%)
PP2C_C 284..352 CDD:285117 1/5 (20%)
HAB1NP_001185385.1 PP2Cc 180..499 CDD:214625 93/313 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.