DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and HAB2

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001322988.1 Gene:HAB2 / 838330 AraportID:AT1G17550 Length:511 Species:Arabidopsis thaliana


Alignment Length:333 Identity:92/333 - (27%)
Similarity:154/333 - (46%) Gaps:86/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SMQGWRLEMEDS-----HSAACRLKD------------PFATWSYFAVFDGHAGSQISLHCAEHL 79
            |:.|.|.||||:     |.....:|.            |:.|..:|.|:|||.|:|::.:|.:.:
plant   193 SICGGRSEMEDAVRALPHFLKIPIKMLMGDHEGMSPSLPYLTSHFFGVYDGHGGAQVADYCHDRI 257

  Fly    80 MSTILES-ESFSKHKYEAGIREG------------FLQLDEDMR-KLYHDQQG------------ 118
            .|.:.|. |...:........||            :|::|:::: |:.....|            
plant   258 HSALAEEIERIKEELCRRNTGEGRQVQWEKVFVDCYLKVDDEVKGKINRPVVGSSDRMVLEAVSP 322

  Fly   119 ---GSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMI--- 177
               ||||:...|....|.:.||||||||:.|...::..::||||....|..||:.|||.|:.   
plant   323 ETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGKVIQWQG 387

  Fly   178 KRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEV 242
            .|::|.||:||:.||         ..::..|.|:|::....|:..||.:::|.||:||||::.|.
plant   388 ARVSGVLAMSRSIGD---------QYLEPFVIPDPEVTFMPRAREDECLILASDGLWDVMSNQEA 443

  Fly   243 CEFIRSRLLVTYD----LPMIVNSVLD-------------ICLHKGSRDNMTLLLLLLPGAPKVD 290
            |:|.|.|:|..:.    ||:....|.:             :.:..||:||::::::.|       
plant   444 CDFARRRILAWHKKNGALPLAERGVGEDQACQAAAEYLSKLAIQMGSKDNISIIVI
DL------- 501

  Fly   291 MDAVKAER 298
                ||:|
plant   502 ----KAQR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 88/310 (28%)
PP2C_C 284..352 CDD:285117 3/15 (20%)
HAB2NP_001322988.1 PP2Cc 179..499 CDD:214625 88/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.