DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and AT1G07160

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_172196.1 Gene:AT1G07160 / 837227 AraportID:AT1G07160 Length:380 Species:Arabidopsis thaliana


Alignment Length:288 Identity:92/288 - (31%)
Similarity:146/288 - (50%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLK-DPFATWSYFAVFDGHAGSQISL 73
            :.|..|.:|.|..|:|  |.|...:|.|..|||..||...|: ||  ..:.|.|:|||.|...:.
plant   107 DTPREESRAVEREGDG--YSVYCKRGKREAMEDRFSAITNLQGDP--KQAIFGVYDGHGGPTAAE 167

  Fly    74 HCAEHLMSTIL------ESESFSKHKYEAGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDKI 132
            ..|::|.|.||      .:||    |.|..::.|:|..|.:..| ..:.:|||..:...:|...:
plant   168 FAAKNLCSNILGEIVGGRNES----KIEEAVKRGYLATDSEFLK-EKNVKGGSCCVTALISDGNL 227

  Fly   133 YLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSV----MIKRINGTLAVSRAFGDY 193
            .:.|.||.|||:|..|.|...|.||:|....|:.||:::||.|    .:.||.|:|||||..||.
plant   228 VVANAGDCRAVLSVGGFAEALTSDHRPSRDDERNRIESSGGYVDTFNSVWRIQGSLAVSRGIGDA 292

  Fly   194 DFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYD--L 256
            ..|         |.:..||:|.:...:...||:::|.||:||.:::.|..:..|.....|..  .
plant   293 HLK---------QWIISEPEINILRINPQHEFLILASDGLWDKVSNQEAVDIARPFCKGTDQKRK 348

  Fly   257 PMIV-NSVLDICLHKGSRDNMTLLLLLL 283
            |::. ..::|:.:.:||.|:::::|:.|
plant   349 PLLACKKLVDLSVSRGSLDDISVMLIQL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 84/263 (32%)
PP2C_C 284..352 CDD:285117 92/288 (32%)
AT1G07160NP_172196.1 PP2Cc 122..376 CDD:238083 86/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.