DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and AHG1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_199989.1 Gene:AHG1 / 835250 AraportID:AT5G51760 Length:416 Species:Arabidopsis thaliana


Alignment Length:352 Identity:104/352 - (29%)
Similarity:155/352 - (44%) Gaps:95/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGGFLEKP----------------ETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDP 53
            :||||..|                |||.:.        .|.:.|:.|...:||||.:....|..|
plant    78 IGGFLAPPAASSCQKSEAPVWKGEETEDEP--------LYGIVSVMGRSRKMEDSVTVKPNLCKP 134

  Fly    54 FATWS----YFAVFDGHAGSQISLHCA--------EHLMSTILESESFSKH-----KYEAGIREG 101
            .....    :|||:|||.|||:|..|:        |.|...:.|.|..|::     |:...::..
plant   135 EVNRQRPVHFFAVYDGHGGSQVSTLCSTTMHTFVKEELEQNLEEEEEGSENDVVERKWRGVMKRS 199

  Fly   102 FLQLDE-----------------DMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGA 149
            |.::||                 |.|:.   ...||||:...::.|.|.:.|.||||||:.|||.
plant   200 FKRMDEMATSTCVCGTSVPLCNCDPREA---AISGSTAVTAVLTHDHIIVANTGDSRAVLCRNGM 261

  Fly   150 AVISTIDHKPFSPKEQERIQNAGGSVMI---KRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPE 211
            |:..:.||||..|.|:.||:.|||.|::   .|:.|.||.|||.||...|         .||:.|
plant   262 AIPLSNDHKPDRPDERARIEAAGGRVLVVDGARVEGILATSRAIGDRYLK---------PMVAWE 317

  Fly   212 PDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEF----IRSRLLVTYDLPMIV------------ 260
            |::....|...||.:|:|.||:|||::|...|:.    :|.....:.||..:.            
plant   318 PEVTFMRRESGDECLVLASDGLWDVLSSQLACDIARFCLREETPSSLDLNRMAQEDDNDGEQNPS 382

  Fly   261 NSVL------DICLHKGSRDNMTLLLL 281
            .|||      .:.|.:.|.||::::::
plant   383 RSVLAATLLTRLALGRQSSDNISVVVI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 96/308 (31%)
PP2C_C 284..352 CDD:285117
AHG1NP_199989.1 PP2Cc 109..411 CDD:238083 96/313 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.