DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nil and AT5G01700

DIOPT Version :10

Sequence 1:NP_651472.2 Gene:Nil / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001031819.1 Gene:AT5G01700 / 831695 AraportID:AT5G01700 Length:382 Species:Arabidopsis thaliana


Alignment Length:248 Identity:77/248 - (31%)
Similarity:110/248 - (44%) Gaps:59/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KDPFATWSYF---------AVFDGHA--GSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQ 104
            :|....|..|         .|||||.  |.:||.|..|:|.|.:......||...:..|.....|
plant    61 QDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISRHVCENLPSRVHSKIRSSKSAGDENIENNSSQ 125

  Fly   105 LDEDMRKLYHD------QQ---------------GGSTAICVFVSPDKIYLVNCGDSRAVI---S 145
            ..|::.:.:.|      :|               .|:||:.||...|.:.:.|.|.||||:   |
plant   126 SQEELFREFEDILVTFFKQIDSELGLDSPYDSFCSGTTAVTVFKQADCLVIANLGHSRAVLGTRS 190

  Fly   146 RNG-AAVISTIDHKPFSPKEQERIQNAGGSVM-------IKRI-------NGTLAVSRAFGDYDF 195
            :|. .||..|:|.||...:|.|||.:..|.|.       :.|:       .| ||:||||||:..
plant   191 KNSFKAVQLTVDLKPCVQREAERIVSCKGRVFAMEEEPDVYRVWMPDDDCPG-LAMSRAFGDFCL 254

  Fly   196 KNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRS 248
            |:.|        :...||:.....|..|||:|:|.||||||:::.||.:.:.|
plant   255 KDYG--------LVCIPDVFCRKVSREDEFVVLATDGIWDVLSNEEVVKVVGS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NilNP_651472.2 PP2Cc 27..277 CDD:238083 77/248 (31%)
PP2C_C 284..355 CDD:429684
AT5G01700NP_001031819.1 PP2Cc 47..337 CDD:238083 77/248 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.