DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and TAP38

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_194509.1 Gene:TAP38 / 828893 AraportID:AT4G27800 Length:388 Species:Arabidopsis thaliana


Alignment Length:293 Identity:96/293 - (32%)
Similarity:150/293 - (51%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGS--------QISLHCAEHLMS- 81
            :|:..:|:||:|.||||.........|.|   ||.|||||||||        ::...|...|.: 
plant    58 IRWGYTSVQGFRDEMEDDIVIRSDAVDSF---SYAAVFDGHAGSSSVKFLREELYKECVGALQAG 119

  Fly    82 TILESESFSKHKYEAGIREGFLQLDEDMRKLY-----HDQQGGSTAICVFVSPDKIYLVNCGDSR 141
            ::|....|:..| ||.|: .|..:|.::.|..     .:.:.||||..:.:..|..::.:.|||.
plant   120 SLLNGGDFAAIK-EALIK-AFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGDSC 182

  Fly   142 AVISRNGAAVISTIDHKPFSP-----KEQERIQNAGGSVMIKRINGTLAVSRAFGDYDF---KND 198
            ||:||:|.....|..|:|:..     :|.:|::.|||.::..||.|.:||||||||..|   |||
plant   183 AVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIRFKTKKND 247

  Fly   199 GSKSPVDQ----------------MVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIR 247
            ..|..||:                ||...|||.....:...|||::|.||:||.|.||:|..::|
plant   248 MLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWDYMKSSDVVSYVR 312

  Fly   248 SRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLL 280
            .:|....::.:...|:..:.|.:.|:||:::::
plant   313 DQLRKHGNVQLACESLAQVALDRRSQDNISIII 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 96/287 (33%)
PP2C_C 284..352 CDD:285117
TAP38NP_194509.1 PP2Cc 58..348 CDD:238083 96/293 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.