DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and AT4G11040

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_192842.1 Gene:AT4G11040 / 826705 AraportID:AT4G11040 Length:295 Species:Arabidopsis thaliana


Alignment Length:290 Identity:57/290 - (19%)
Similarity:117/290 - (40%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCA- 76
            :.:.:...|||      |.|:.|.:..|.   :|...:.|...::..|.:|||       |..| 
plant    70 DKDGKTNAGHG------VVSVMGRQRAMT---TAVSTVVDEIPSYDIFGIFDG-------LRLAK 118

  Fly    77 --EHLMSTILESESFSKHKYEAGIREGFLQLDEDMRKLYHDQQG--GST--AICVFVSPDKIYLV 135
              |..:..:::.|..:.|  ..|:...:   ::.|:..:.:..|  |:|  |:...|..:::.::
plant   119 FFEDRLRRLVKEEVKACH--GRGVAADW---NKVMKSCFSEAVGTVGTTTSAVVTIVGKEEVIVL 178

  Fly   136 NCGDSRAVI-SRNGAAV-ISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKND 198
            ..|.:|.|: |.:|.|: :..|.|                                         
plant   179 CRGGARVVLYSHDGVALPLCHIHH----------------------------------------- 202

  Fly   199 GSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTY-DLP---MI 259
             .|..|:|::.      :..|.:.|:|||:||||:|||::..:..:.::..|   | .||   .|
plant   203 -HKDGVEQILK------IHKRKKIDDFIVLACDGLWDVVSDDDTYQLVKRCL---YGKLPPDGCI 257

  Fly   260 VNS--------VLDICLHKGSRDNMTLLLL 281
            ..|        :.::.:.:||::|:.::::
plant   258 SESSSTKAAVILAELAIARGSKENINVIVI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 54/270 (20%)
PP2C_C 284..352 CDD:285117
AT4G11040NP_192842.1 PP2Cc 79..287 CDD:214625 56/279 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.