DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and AT3G27140

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_189350.2 Gene:AT3G27140 / 822333 AraportID:AT3G27140 Length:245 Species:Arabidopsis thaliana


Alignment Length:283 Identity:66/283 - (23%)
Similarity:114/283 - (40%) Gaps:74/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQ 104
            |||..|....|... ...:.|.|:.||.|.:.:...|::|...|:|.....:|:.|..       
plant     1 MEDRFSTITNLHGD-RKQAIFGVYVGHGGVKAAECPAKNLDKNIVEEVVGKRHELEIA------- 57

  Fly   105 LDEDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQ 169
                       :.|||:.:...||...:.:.|.||.|||:|..|.|                   
plant    58 -----------EAGGSSCVTALVSEGSLVVSNAGDCRAVMSVGGVA------------------- 92

  Fly   170 NAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHD-EFIVVACDGI 233
                       .|:|.|.|..||...|         :.|..||:..: :|.||| ||:::|..|:
plant    93 -----------KGSLVVPRGIGDAQLK---------KWVIAEPETKI-SRVEHDHEFLILASHGL 136

  Fly   234 WDVMTSSEVCEFIRSRLLVTYDLPMIV---NSVLDICLHKGSRDNMTLLLLLLPGAP-------- 287
            ||.:::.|..:..|...|.| :.|:::   ..::|:...:||.|:::  ::|:|..|        
plant   137 WDKVSNQEAVDIARPFCLRT-EKPLLLAACKKLVDLSASRGSFDDIS--VMLIPLRPVRIEKRGI 198

  Fly   288 KVDMDAVKAERSLDQTIVQITKE 310
            ..|:.:.||........:.:|::
plant   199 LEDVSSSKANSIARDIAISVTRD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 59/240 (25%)
PP2C_C 284..352 CDD:285117 6/35 (17%)
AT3G27140NP_189350.2 PP2Cc 1..188 CDD:238083 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.