DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PP2CA

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_187748.1 Gene:PP2CA / 820314 AraportID:AT3G11410 Length:399 Species:Arabidopsis thaliana


Alignment Length:300 Identity:90/300 - (30%)
Similarity:139/300 - (46%) Gaps:69/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSMQGWRLEMEDSHSA-ACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILES-------- 86
            :|:.|.|.:|||:.|. ...|:.......::.|||||..|.::..|.|.|...:.:.        
plant   108 TSVCGRRRDMEDAVSIHPSFLQRNSENHHFYGVFDGHGCSHVAEKCRERLHDIVKKEVEVMASDE 172

  Fly    87 ------ESFSKHKYEAGIREGFLQLDEDMRKLYHD----------QQGGSTAICVFVSPDKIYLV 135
                  :||.|...|...||..|.::...|.:.:.          ...||||:...|:|:||.:.
plant   173 WTETMVKSFQKMDKEVSQRECNLVVNGATRSMKNSCRCELQSPQCDAVGSTAVVSVVTPEKIIVS 237

  Fly   136 NCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMI---KRINGTLAVSRAFGDYDFKN 197
            ||||||||:.|||.|:..::||||..|.|..|||.|||.|:.   .|:.|.||:|||.||...| 
plant   238 NCGDSRAVLCRNGVAIPLSVDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLK- 301

  Fly   198 DGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIR--------------- 247
                    ..|.|:|::.|.:|::.||.:::|.||:|||:.:...|...|               
plant   302 --------PYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCLRGAGAGDDSDAA 358

  Fly   248 ------SRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLL 281
                  :.||:|           .:.|.:.|.||::::::
plant   359 HNACSDAALLLT-----------KLALARQSSDNVSVVVV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 90/294 (31%)
PP2C_C 284..352 CDD:285117
PP2CANP_187748.1 PP2Cc 106..349 CDD:214625 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.