DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and AT2G30020

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_180563.1 Gene:AT2G30020 / 817553 AraportID:AT2G30020 Length:396 Species:Arabidopsis thaliana


Alignment Length:282 Identity:89/282 - (31%)
Similarity:143/282 - (50%) Gaps:25/282 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCA 76
            |..|.:..|..|:|  |.|...:|.|..|||..||...|... ...:.|.|:|||.|.:.:...|
plant   126 PREECREVEREGDG--YSVYCKRGRREAMEDRFSAITNLHGD-RKQAIFGVYDGHGGVKAAEFAA 187

  Fly    77 EHLMSTILESESFSKHKYE--AGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGD 139
            ::|...|:|.....:.:.|  ..::.|:|..|....| ..|.:|||..:...|:...:.:.|.||
plant   188 KNLDKNIVEEVVGKRDESEIAEAVKHGYLATDASFLK-EEDVKGGSCCVTALVNEGNLVVSNAGD 251

  Fly   140 SRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSV----MIKRINGTLAVSRAFGDYDFKNDGS 200
            .|||:|..|.|...:.||:|....|::||:..||.|    .:.||.|:|||||..||...|    
plant   252 CRAVMSVGGVAKALSSDHRPSRDDERKRIETTGGYVDTFHGVWRIQGSLAVSRGIGDAQLK---- 312

  Fly   201 KSPVDQMVSPEPDIIVCNRSEHD-EFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIV---N 261
                 :.|..||:..: :|.||| ||:::|.||:||.:::.|..:..|...|.| :.|:::   .
plant   313 -----KWVIAEPETKI-SRIEHDHEFLILASDGLWDKVSNQEAVDIARPLCLGT-EKPLLLAACK 370

  Fly   262 SVLDICLHKGSRDNMTLLLLLL 283
            .::|:...:||.|:::::|:.|
plant   371 KLVDLSASRGSSDDISVMLIPL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 82/259 (32%)
PP2C_C 284..352 CDD:285117 89/282 (32%)
AT2G30020NP_180563.1 PP2Cc 139..392 CDD:238083 84/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.