DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and HAI3

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_180499.1 Gene:HAI3 / 817487 AraportID:AT2G29380 Length:362 Species:Arabidopsis thaliana


Alignment Length:330 Identity:97/330 - (29%)
Similarity:155/330 - (46%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RYCVSSMQGWRLEMEDS---HSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTI---LE 85
            ||.|||:.|.|.||||:   |.:....|:......||.|:|||..|.::..|.|.|...:   |.
plant    77 RYGVSSVCGRRREMEDAVAIHPSFSSPKNSEFPQHYFGVYDGHGCSHVAARCRERLHKLVQEELS 141

  Fly    86 SESFSKHKYEAGIREGFLQLDE----------------DMRKLYHDQQGGSTAICVFVSPDKIYL 134
            |:...:.:::..:...|.::|:                |::....|.. ||||:...::||||.:
plant   142 SDMEDEEEWKTTMERSFTRMDKEVVSWGDSVVTANCKCDLQTPACDSV-GSTAVVSVITPDKIVV 205

  Fly   135 VNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVM---IKRINGTLAVSRAFGDYDFK 196
            .||||||||:.|||..|..:.||||..|.|.:||:.|||.|:   ..|:.|.||:|||.||...|
plant   206 ANCGDSRAVLCRNGKPVPLSTDHKPDRPDELDRIEGAGGRVIYWDCPRVLGVLAMSRAIGDNYLK 270

  Fly   197 NDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVN 261
                     ..||.||::.:.:|.: |:.:::|.||:|||:::...|                  
plant   271 ---------PYVSCEPEVTITDRRD-DDCLILASDGLWDVVSNETAC------------------ 307

  Fly   262 SVLDICLHKGSR--DNMTLLLLLLPGAPKVDMDAVKAERSLDQTIVQITKEVIEKHEIHDFETLI 324
            ||..:||..|.|  ||               .|...::::..:..|.:||..:.::...:...::
plant   308 SVARMCLRGGGRRQDN---------------EDPAISDKACTEASVLLTKLALARNSSDNVSVVV 357

  Fly   325 RLMKR 329
            ..::|
plant   358 IDLRR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 92/276 (33%)
PP2C_C 284..352 CDD:285117 5/46 (11%)
HAI3NP_180499.1 PP2Cc 73..358 CDD:214625 96/324 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.