DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and DBP1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:283 Identity:89/283 - (31%)
Similarity:137/283 - (48%) Gaps:23/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GWRLEMEDSHSAACRLKDPFATW-------SYFAVFDGHAGSQISLHCAEHLMSTILESESFSKH 92
            |.|..|||::.......|.|...       :::.|||||.|...:.....|:...|:|.:.|.. 
plant    97 GSRSSMEDAYLCVDNFMDSFGLLNSEAGPSAFYGVFDGHGGKHAAEFACHHIPRYIVEDQEFPS- 160

  Fly    93 KYEAGIREGFLQLDE---DMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVIST 154
            :....:...|||.|.   :...|......|:||:...:....:.:.|.||.|||:||.|.|:..:
plant   161 EINKVLSSAFLQTDTAFLEACSLDGSLASGTTALAAILFGRSLVVANAGDCRAVLSRQGKAIEMS 225

  Fly   155 IDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDF-----KNDGSK-SPVDQMVSPEPD 213
            .||||.|.||:.||:.:||.|....:||.|.|:||.||:..     |.|||. .|    :..||:
plant   226 RDHKPMSSKERRRIEASGGHVFDGYLNGQLNVARALGDFHMEGMKKKKDGSDCGP----LIAEPE 286

  Fly   214 IIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTL 278
            ::....:|.|||:::.|||:|||..|....:|.|.||....|..|....:::..|.:.|.||:|.
plant   287 LMTTKLTEEDEFLIIGCDGVWDVFMSQNAVDFARRRLQEHNDPVMCSKELVEEALKRKSADNVTA 351

  Fly   279 LLLLLPGAPKVDMDA--VKAERS 299
            :::.|...|..::.|  ::..||
plant   352 VVVCLQPQPPPNLVAPRLRVHRS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 83/257 (32%)
PP2C_C 284..352 CDD:285117 4/18 (22%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 89/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.