DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and AT2G25070

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001324497.1 Gene:AT2G25070 / 817045 AraportID:AT2G25070 Length:355 Species:Arabidopsis thaliana


Alignment Length:353 Identity:118/353 - (33%)
Similarity:177/353 - (50%) Gaps:58/353 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGS 69
            ||.:|..|:|||.:::|..:.||:.:|||||||..|||:|:|...|.|   ..|:|.|:|||.|.
plant     1 MGTYLSSPKTEKLSEDGENDKLRFGLSSMQGWRATMEDAHAAILDLDD---KTSFFGVYDGHGGK 62

  Fly    70 QISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDM------RKL---------------- 112
            .::..||::|...::.:|::.....|..:|..|.::|:.|      |:|                
plant    63 VVAKFCAKYLHQQVISNEAYKTGDVETSLRRAFFRMDDMMQGQRGWRELAVLGDKMNKFSGMIEG 127

  Fly   113 -----------------------YHDQQG---GSTAICVFVSPDKIYLVNCGDSRAVISRNGAAV 151
                                   :.|..|   |.||....:...|:::.|.||||.||||...|.
plant   128 FIWSPRSGDTNNQPDSWPLEDGPHSDFTGPTSGCTACVALIKDKKLFVANAGDSRCVISRKSQAY 192

  Fly   152 ISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIV 216
            ..:.||||....|:|||..|||.:...||||:|.::||.||.:||.:.......|||:.:|||..
plant   193 NLSKDHKPDLEVEKERILKAGGFIHAGRINGSLNLTRAIGDMEFKQNKFLPSEKQMVTADPDINT 257

  Fly   217 CNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSR-----DNM 276
            .:..:.|:|:|||||||||.|:|.|:.:||..:|.....|..:...|:|.||...:.     |||
plant   258 IDLCDDDDFLVVACDGIWDCMSSQELVDFIHEQLKSETKLSTVCEKVVDRCLAPDTATGEGCDNM 322

  Fly   277 TLLLLLL--PGAPKVDMDAVKAERSLDQ 302
            |::|:..  |...:.:.:..|.|.|.|:
plant   323 TIILVQFKKPNPSETEPEDSKPEPSEDE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 101/302 (33%)
PP2C_C 284..352 CDD:285117 5/19 (26%)
AT2G25070NP_001324497.1 PP2Cc 14..327 CDD:214625 105/315 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.