DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ILKAP

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:298 Identity:94/298 - (31%)
Similarity:143/298 - (47%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLRYCVSSMQGWRLEMEDSH------SAACRLKDPFAT-WSYFAVFDGHAGSQISLHCAEHLMST 82
            ||:..|:..:|.|.||:|:|      :..||......| .|||||||||.|.:.|...|::|...
Human   106 GLKGYVAERKGEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQN 170

  Fly    83 ILESESFSKHKYEAG------------IREGFLQLDEDMRKLYHDQ----QGGSTAICVFVSPDK 131
            ::       .|:..|            :.:.|...||:..|....|    :.||||.||....:.
Human   171 LI-------RKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNI 228

  Fly   132 IYLVNCGDSRAVI------SRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAF 190
            :|:.|.|||||::      |:..||:..:.:|.|...:|:.|||.|||:|...|:.|.|.|||:.
Human   229 LYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSI 293

  Fly   191 GDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRL----L 251
            ||..:|..|        |:..|||..|..:.:|.||::||||::.|.|..|...||.|.|    :
Human   294 GDGQYKRCG--------VTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKI 350

  Fly   252 VTYD--------LPMIVNSVLDICLHKGSRDNMTLLLL 281
            .|.:        .....|.:.:..:.:||.||:|::::
Human   351 QTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 91/290 (31%)
PP2C_C 284..352 CDD:285117
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
PP2Cc 108..390 CDD:238083 92/296 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.