DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ppm1lb

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001307112.1 Gene:ppm1lb / 767640 ZFINID:ZDB-GENE-060929-136 Length:348 Species:Danio rerio


Alignment Length:278 Identity:78/278 - (28%)
Similarity:140/278 - (50%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VSSMQGWRLEMED-----------SHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTI 83
            |.|:||.|..|||           ||.|            .|:::|||.|...:.:...||...:
Zfish    84 VYSIQGRRDHMEDRFDILTDTRNRSHPA------------IFSIYDGHGGEAAAEYAKAHLPIML 136

  Fly    84 LES-ESFSKHK------YEAGIREGFLQLD-EDMRKLYHD-QQGGSTAICVFVSPDKIYLVNCGD 139
            .:. :.:.:.|      .:|.:|:..|.:| |.:.||... .:.|:|.:...:|..::.:.|.||
Zfish   137 RQQLQRYERQKENSAVSRQAILRQQILNMDREILEKLTASYDEAGTTCLVALLSEKELTVANVGD 201

  Fly   140 SRAVI-SRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIK---RINGTLAVSRAFGDYDFKNDGS 200
            ||||: .::|.|:..:.||||:..||::||:.|||.:...   |:.|.|::||:.||:..|.   
Zfish   202 SRAVLCDKDGNAIPLSHDHKPYQLKERKRIKKAGGFISFSGSWRVQGVLSMSRSLGDFPLKK--- 263

  Fly   201 KSPVDQMVSPEPDIIVCNRSE-HDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMI-VNSV 263
                .:::.|:||::..:... ..:|:::|.||:||..::.|...||:.||    |.|.. ..|:
Zfish   264 ----LKVLIPDPDLMTFDLDTLQPQFMILASDGLWDTFSNEEAVHFIKERL----DEPHFGAKSI 320

  Fly   264 LDICLHKGSRDNMTLLLL 281
            :....::|..||:|::::
Zfish   321 VLQSFYRGCPDNITVMVV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 77/272 (28%)
PP2C_C 284..352 CDD:285117
ppm1lbNP_001307112.1 PP2Cc 82..340 CDD:238083 78/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.