DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1j

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_082258.2 Gene:Ppm1j / 71887 MGIID:1919137 Length:507 Species:Mus musculus


Alignment Length:322 Identity:71/322 - (22%)
Similarity:117/322 - (36%) Gaps:119/322 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EDSHSAA-CRLKDPFATWSYFAVFDGHAGS--------QISLHCAEHLM---------------- 80
            |.||:.. |        :.|:.:||||||.        .:..|..|.|.                
Mouse   143 EPSHNQGFC--------FYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEILKDPLPPPLCL 199

  Fly    81 ------------STILESESFSKHKYE--------AGIREGFLQLDEDM--RKLYHDQQGGSTAI 123
                        |.::..:|....:.|        ..|...|..:||.|  .:..|..:||..|:
Mouse   200 PSTPGTPGAPSPSQLVSPQSCWSPQKEVTHDSLIVGAIENAFHLMDEQMARERRGHQVEGGCCAL 264

  Fly   124 CVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPK-EQERIQNAG--------------- 172
            .|.....|:|:.|.|||||:|.|||..:..:   :.|:|: |::|:|..|               
Mouse   265 VVLYLLGKMYVANAGDSRAIIVRNGEIIPMS---REFTPETERQRLQLLGFLKPELLGSEFTHLE 326

  Fly   173 ----------GSVMI------------------------------KRINGTLAVSRAFGDYDFKN 197
                      |..|:                              .|:..|:.|:|..||::.|.
Mouse   327 FPRRVQPKELGQRMLYRDQNMTGWAYKKIEVEDLRFPLVCGEGKKARVMATIGVTRGLGDHNLKV 391

  Fly   198 DGSKSPVDQMVSPEPDIIVCNRSEH----DEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYD 255
            ..|...:...:|..|::.|.:.:::    |:.:|:..||:|||...|||...: .|:|.:|:
Mouse   392 CSSTLSIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTNDSEVAATV-DRVLSSYE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 71/322 (22%)
PP2C_C 284..352 CDD:285117
Ppm1jNP_082258.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
PP2Cc 105..499 CDD:238083 71/322 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..220 1/22 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.