DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1f

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_789803.1 Gene:Ppm1f / 68606 MGIID:1918464 Length:452 Species:Mus musculus


Alignment Length:271 Identity:77/271 - (28%)
Similarity:131/271 - (48%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VSSMQGWRLEMEDSHSAACRLKDPFAT-----WSYFAVFDGHAGSQISLHCAEHLMSTILESESF 89
            :.:::..|.:|||.|.:.......|..     .:||||||||.|...:.:.:.|:.:.       
Mouse   156 IHAIRNTRRKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHVHTN------- 213

  Fly    90 SKHKYE------AGIREGFLQLDE-DMRKLYHDQ-QGGSTAICVFVSPDKIYLVNCGDSRAVISR 146
            :.|:.|      |.::|.|...|| .::|...:: |.|:|.:|..::...:::...|||:.::.:
Mouse   214 ASHQPELRTNPAAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQ 278

  Fly   147 NGAAVISTIDHKPFSPKEQERIQNAGGSVMIK---RINGTLAVSRAFGDYDFKNDGSKSPVDQMV 208
            .|..|.....|||....|:.||:..||.|.:.   |:|||||||||.||...|         ..|
Mouse   279 QGRVVKLMEPHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQK---------PYV 334

  Fly   209 SPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPM-IVNSVLDICLHKGS 272
            |.|.|......:..::::::||||.:||:...||...:...||......| |...::.:...:||
Mouse   335 SGEADAASRELTGSEDYLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGS 399

  Fly   273 RDNMTLLLLLL 283
            .||:|::::.|
Mouse   400 HDNITVMVVFL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 75/263 (29%)
PP2C_C 284..352 CDD:285117 77/271 (28%)
Ppm1fNP_789803.1 PP2C 152..403 CDD:366121 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834863
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.