DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1m

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_080723.3 Gene:Ppm1m / 67905 MGIID:1915155 Length:462 Species:Mus musculus


Alignment Length:338 Identity:75/338 - (22%)
Similarity:125/338 - (36%) Gaps:109/338 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPE-TEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISL 73
            ||.| .|.||..|     :.|:...: :.:|........|  .:.|.|..|:|:||||.|...::
Mouse    80 EKSEFNEDQAACG-----KLCIRRCE-FGIEEHQEWLTVC--PEEFLTGHYWALFDGHGGPAAAI 136

  Fly    74 HCAEHLMSTI--------------------------------LESESFSKHKYEAGIREGFLQLD 106
            ..|..|.|.:                                :|.:.........|..|...|..
Mouse   137 LAANTLHSCLRRQLEAVVEGMIAPQPPMHLSGRCVCPSDPQFVEEKGIQAEDLVIGALENAFQEC 201

  Fly   107 EDM--RKL-YHDQQGGSTAICVFVSPDKIYLVNCGDSRAV-ISRNGAAVISTIDHKPFSPK-EQE 166
            :|:  |:| ...|.||.||:.......|:|:.|.|||||: :.|:....:|:    .|:|: |::
Mouse   202 DDVIGRELEASGQVGGCTALVAVFLQGKLYVANAGDSRAILVRRHEIRQLSS----EFTPETERQ 262

  Fly   167 RIQ--------------------------NAGGSVMIK--------------------------- 178
            |||                          :.|..|:.:                           
Mouse   263 RIQQLAFTYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMRGWSYKRVEKSDLKYPLIHGQGR 327

  Fly   179 --RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCN----RSEHDEFIVVACDGIWDVM 237
              |:.|||||||..||:..:...:...:...:...|.:.|.:    ..:.::.:|:|.||:|||:
Mouse   328 QARLLGTLAVSRGLGDHQLRVLDTDIQLKPFLLSIPQVTVLDVHQLAVQEEDVVVMATDGLWDVL 392

  Fly   238 TSSEVCEFIRSRL 250
            ::.:|...:||.|
Mouse   393 SNEQVALLVRSFL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 68/320 (21%)
PP2C_C 284..352 CDD:285117
Ppm1mNP_080723.3 PP2Cc 109..452 CDD:238083 66/303 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.