DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ilkap

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_072128.2 Gene:Ilkap / 64538 RGDID:620128 Length:392 Species:Rattus norvegicus


Alignment Length:328 Identity:98/328 - (29%)
Similarity:149/328 - (45%) Gaps:67/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GGFLEKPETEKQAQEGHGN-----------GLRYCVSSMQGWRLEMEDSH------SAACRLKDP 53
            |...:.||.||...|....           ||:..|:..:|.|.||:|:|      :..|.....
  Rat    76 GAKRKAPEEEKNGGEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITQECNPPSS 140

  Fly    54 FAT-WSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKHKYEAG------------IREGFLQL 105
            ..| .|||||||||.|.:.|...|::|...::       .|:..|            :.:.|...
  Rat   141 LITRVSYFAVFDGHGGIRASKFAAQNLHQNLI-------RKFPKGDVISVEKTVKRCLLDTFKHT 198

  Fly   106 DEDMRKLYHDQ----QGGSTAICVFVSPDKIYLVNCGDSRAVI------SRNGAAVISTIDHKPF 160
            ||:..|....|    :.||||.||....:.:|:.|.|||||::      |:..||:..:.:|.|.
  Rat   199 DEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPT 263

  Fly   161 SPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEF 225
            ..:|:.|||.|||:|...|:.|.|.|||:.||..:|..|        |:..|||..|..:.:|.|
  Rat   264 QYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCG--------VTSVPDIRRCQLTPNDRF 320

  Fly   226 IVVACDGIWDVMTSSEVCEFIRS-----RLLVTYDLPMI-------VNSVLDICLHKGSRDNMTL 278
            |::||||::.|.|..|...||.|     ::......|.:       .|.:.:..:.:||.||:|:
  Rat   321 ILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTV 385

  Fly   279 LLL 281
            :::
  Rat   386 MVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 89/290 (31%)
PP2C_C 284..352 CDD:285117
IlkapNP_072128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 5/14 (36%)
PP2Cc 108..390 CDD:238083 90/296 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.