DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ilkap

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_012825945.1 Gene:ilkap / 595059 XenbaseID:XB-GENE-1000324 Length:364 Species:Xenopus tropicalis


Alignment Length:290 Identity:93/290 - (32%)
Similarity:146/290 - (50%) Gaps:43/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LRYCVSSMQGWRLEMEDSH-----SAACRLKDP-FATWSYFAVFDGHAGSQISLHCAEHLMSTIL 84
            |:..|:..:|.|.|::|:|     |..|:...| ....|||||||||.|::.|...|::|....:
 Frog    80 LKAHVAERRGEREELQDAHTICDLSQDCQPMPPDLLRLSYFAVFDGHGGTRASRFAAQNLHQNFV 144

  Fly    85 ------ESESFSKHKYEAGIREGFLQLDEDMRKLYHDQ----QGGSTAICVFVSPDKIYLVNCGD 139
                  |..|..| ..:..|.:.|.|.|||..|....|    :.|:|||||.|:.:.:|:.|.||
 Frog   145 KKIPRGEGSSVDK-AMKRCILDAFKQTDEDFLKQAASQKPAWKDGTTAICVLVADNILYIANLGD 208

  Fly   140 SRAVISR----NGAAVISTI--DHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKND 198
            |||::.|    |...|:.::  :|.|...:|:.|||.|||:|...|:.|.|.|||:.||..:|..
 Frog   209 SRALLCRINKENQKHVVLSLSREHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRY 273

  Fly   199 GSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFI----RSRLLVTYDLPMI 259
            |        |...|::..|..::.|.||::||||::...::.|...||    :.:.....|.|..
 Frog   274 G--------VISTPEVKRCPLTDSDRFILLACDGLFKAFSAEEAVTFILTHTQEKSSPAEDGPPD 330

  Fly   260 VNSVLDICLH--------KGSRDNMTLLLL 281
            .:|:.:...|        :|:.||:|:|::
 Frog   331 FDSLYESACHRLANEAVRRGAADNVTVLIV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 90/283 (32%)
PP2C_C 284..352 CDD:285117
ilkapXP_012825945.1 PP2Cc 81..362 CDD:238083 92/289 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.