DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PPM1H

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_065751.1 Gene:PPM1H / 57460 HGNCID:18583 Length:514 Species:Homo sapiens


Alignment Length:400 Identity:86/400 - (21%)
Similarity:143/400 - (35%) Gaps:162/400 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMGGFLEKP---ETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDG 65
            |.|.....|   .:::::...:|.||:.         .|..:|...:|.         |:::|||
Human   106 KAGAVTSTPNRNSSKRRSSLPNGEGLQL---------KENSESEGVSCH---------YWSLFDG 152

  Fly    66 HAGSQISL--------HCAEHLM--------STIL-------ESES------------------- 88
            ||||..::        |..|.|.        |.:|       |.|:                   
Human   153 HAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAASLRGGVG 217

  Fly    89 ------------FSKHK----------YEAGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDK 131
                        |::.|          .|:..:|..||::.: |..| :..||.||:.|.....|
Human   218 APGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERE-RSSY-NISGGCTALIVICLLGK 280

  Fly   132 IYLVNCGDSRAVISRNGAAVISTIDHKPFSPK-EQERIQNAG----------------------- 172
            :|:.|.|||||:|.|||..:..:.:   |:|: |::|:|...                       
Human   281 LYVANAGDSRAIIIRNGEIIPMSSE---FTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRK 342

  Fly   173 --GSVMI------------------------------KRINGTLAVSRAFGDYDFKNDGSKSPVD 205
              |..|:                              .|:..|:.|:|..||:|.|...|...:.
Human   343 ELGKKMLYRDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIK 407

  Fly   206 QMVSPEPDIIVCNRSEH----DEFIVVACDGIWDVMTSSEVCEFIRSRL------------LVTY 254
            ..:|..|::.:.:.|::    |:.:::|.||:|||:::.||.|.|...|            |...
Human   408 PFLSSAPEVRIYDLSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQ 472

  Fly   255 DLPMIVNSVL 264
            ||.|....||
Human   473 DLVMRARGVL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 79/373 (21%)
PP2C_C 284..352 CDD:285117
PPM1HNP_065751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..135 4/34 (12%)
PP2Cc 143..507 CDD:238083 77/353 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.