DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and si:ch211-15p9.2

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001038455.2 Gene:si:ch211-15p9.2 / 562650 ZFINID:ZDB-GENE-060503-577 Length:505 Species:Danio rerio


Alignment Length:315 Identity:77/315 - (24%)
Similarity:114/315 - (36%) Gaps:108/315 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHL----------MSTILESES------- 88
            ||..|||..|:   :....|.||||||||..:...:|.|          :.|::|.|:       
Zfish   104 EDRRSAATCLQ---SRGMLFGVFDGHAGSACAQAVSERLFYYIALSLLPLRTLMEIEAAVESERP 165

  Fly    89 ----FSKHKY-----------------------------------EAGIREGFLQLDEDMR---- 110
                ...||:                                   :...|..|.:||.|:.    
Zfish   166 VLPVLQWHKHPNDYQSTDSGKLYFSSLRTYWQERIDLQENEDCDTQGAFRNAFKRLDNDISLEAQ 230

  Fly   111 -----KLYHDQQ-----GGSTAICVFVSPDKIYLVNCGDSRAVIS-RNG----AAVISTIDHKPF 160
                 .|.|...     .|.||...:|..|.:|:.|.||||||:. :.|    :|...|.||...
Zfish   231 VDIGVPLAHFTPLRVALSGCTACVAYVDQDDLYIANLGDSRAVLGVQQGDGKWSAFTITNDHNAQ 295

  Fly   161 SPKEQERIQN----AGGSVMIK--RINGTLAVSRAFGDYDFK-------------------NDGS 200
            :|.|.:|:.:    .....::|  |:.|.|...|||||..||                   |:.:
Zfish   296 NPNEMKRVLSEHPACEQKTVVKHDRLLGLLIPFRAFGDMKFKWSSELLNRIYEARPELLIGNENA 360

  Fly   201 KS-PVDQMVSP----EPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRL 250
            |. |.:....|    ||:|........|:|:::..||:|::|....|.:.|...|
Zfish   361 KMLPANYHTPPYLTAEPEITYHKLRPQDKFLILGTDGLWELMHRQTVVQVIGEHL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 77/315 (24%)
PP2C_C 284..352 CDD:285117
si:ch211-15p9.2NP_001038455.2 PP2Cc 89..501 CDD:238083 77/315 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.