DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and pdp1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001104628.1 Gene:pdp1 / 558728 ZFINID:ZDB-GENE-060810-70 Length:519 Species:Danio rerio


Alignment Length:373 Identity:82/373 - (21%)
Similarity:132/373 - (35%) Gaps:125/373 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMGGFLEKPETEKQAQEGHGNGLRYCVSSMQGW-------RLEMEDSHSAACRLKDPFATWSYFA 61
            ::...|:..|...:..|..|..|    ||:.|:       ...:||..|||..|:   .....:.
Zfish    71 QVNSILKANEYNFKVPEFDGKNL----SSVMGFDSNQLPANAPIEDRRSAATCLQ---TRGMLYG 128

  Fly    62 VFDGHAGSQISLHCAEHLM----------STILESES---------------------FSKHK-- 93
            |||||||...:...:|.|.          .|::|.|:                     |||..  
Zfish   129 VFDGHAGCACAQALSERLFYYIAVSLLPHETLIELENAVENGRPLHPILQWHKHPNDYFSKEASR 193

  Fly    94 -YEAGIR-----------------------EGFLQLDEDMRKLYHDQQG---------------- 118
             |.:.:|                       ..|.:||.|:.  ...|.|                
Zfish   194 LYFSSLRTYWQELLDLSVPGEQPEVAEALVTAFKRLDNDIS--LEAQVGDPNAFLHYWVLRVAFS 256

  Fly   119 GSTAICVFVSPDKIYLVNCGDSRAVI-----SRNGAAVISTIDHKPFSPKEQERIQ----NAGGS 174
            |:||....:..:::::.|.||.|||:     ..:.:|:..|.||...:..|.:|::    ::...
Zfish   257 GATACVAHIDGNELHVANTGDGRAVLGVQEPDGSFSALTLTNDHNAQNESEVQRVRSEHPHSEAK 321

  Fly   175 VMIK--RINGTLAVSRAFGDYDFK-------------------NDGSK-SPVDQMVSP----EPD 213
            .::|  |:.|.|...|||||..||                   |:.:| .|.:....|    ||:
Zfish   322 TVVKQDRLLGLLMPFRAFGDVKFKWSIELQRRVLESGPDQLHENEHAKFIPPNYHTPPYLTAEPE 386

  Fly   214 IIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLL-VTYDLPMIV 260
            :........|.|:|:..||:|:.:...||...:...|. |...||:.|
Zfish   387 VTRHRLRPQDRFLVLGSDGLWETLHRQEVVRIVGEHLTGVHQQLPVSV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 77/350 (22%)
PP2C_C 284..352 CDD:285117
pdp1NP_001104628.1 PP2Cc 96..511 CDD:238083 75/344 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.