DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ppm1la

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001071068.1 Gene:ppm1la / 556994 ZFINID:ZDB-GENE-061103-118 Length:361 Species:Danio rerio


Alignment Length:301 Identity:94/301 - (31%)
Similarity:156/301 - (51%) Gaps:39/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGHKMGGFLEKPETE-KQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKD---PFATWSYFA 61
            |..::|| |:..:.| .:..|...|.:  .|.|:||.|..|||.......|.:   |    |.||
Zfish    68 MNDRLGG-LDVLDAEFSKTWEFKNNNV--AVYSIQGRRDHMEDRFEVLTDLANRSHP----SIFA 125

  Fly    62 VFDGHAGSQISLHCAEHLMSTILES-ESFSKHK------YEAGIREGFLQLDEDMRKLY---HDQ 116
            :||||.|...:.:...||...:.:. ::|.:.|      |.:.:.:..|.:|.||.:.:   || 
Zfish   126 IFDGHGGEGAADYVKAHLPEALKQQLQAFEREKKDSPLSYPSILEQRILAVDRDMVEKFSASHD- 189

  Fly   117 QGGSTAICVFVSPDKIYLVNCGDSRAVI-SRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIK-- 178
            :.|:|.:...:|..::.:.|.||||.|: .::|.||..:.||||:..||::||:.|||.:...  
Zfish   190 EAGTTCLIALLSDRELTVANVGDSRGVLCDKDGNAVALSHDHKPYQLKERKRIKRAGGFISFNGS 254

  Fly   179 -RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSE-HDEFIVVACDGIWDVMTSSE 241
             |:.|.||:||:.|||..||       ..:|.|:|||:..:..: ..||:::|.||:||..::.|
Zfish   255 WRVQGILAMSRSLGDYPLKN-------LNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEE 312

  Fly   242 VCEFIRSRLLVTYDLPMI-VNSVLDICLHKGSRDNMTLLLL 281
            ...|:|.||    |.|.. ..|::....::|..||:|::::
Zfish   313 AVRFVRERL----DEPHFGAKSIVLQSFYRGCPDNITVMVV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 86/268 (32%)
PP2C_C 284..352 CDD:285117
ppm1laNP_001071068.1 PP2Cc 93..351 CDD:238083 87/275 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.