DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and fig

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_651724.1 Gene:fig / 43511 FlyBaseID:FBgn0039694 Length:314 Species:Drosophila melanogaster


Alignment Length:333 Identity:64/333 - (19%)
Similarity:107/333 - (32%) Gaps:121/333 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEM------------EDSH-------SAACR 49
            ::.|..|:|     .|.|..:...|.|:.:||...:.            |||.       :....
  Fly    25 QLSGRFERP-----PQSGKSSRDPYLVTVVQGRSKKPRFPGERSNQRFGEDSWFVSSTPLAEVMG 84

  Fly    50 LKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDMRKLYH 114
            :.|....|....|..|....::...|:.....:..:..| .::...||.:|        :....|
  Fly    85 VADGVGGWRDLGVDAGRFAKELMSCCSGQTQLSDFDGRS-PRNMLIAGFQE--------LSHREH 140

  Fly   115 DQQGGSTAICVFVSPDK---IYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVM 176
            ...|.||| |:.....|   :|..|.|||..::.|||..:..:::.                   
  Fly   141 PVVGSSTA-CLATMHRKDCTLYTANLGDSGFLVVRNGRVLHRSVEQ------------------- 185

  Fly   177 IKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPE----------PDIIVCNRSEHD----EFIV 227
                           .:||     .:|....|.||          |::.|..|  |.    :.::
  Fly   186 ---------------THDF-----NTPYQLTVPPEDRKESYYCDKPEMAVSTR--HSLLPGDLVL 228

  Fly   228 VACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDMD 292
            :|.||::|.|..|                  ::.|:|:....:|..|       ||.||.:|   
  Fly   229 LATDGLFDNMPES------------------MLLSILNGLKERGEHD-------LLVGASRV--- 265

  Fly   293 AVKAERSL 300
             |:..|.|
  Fly   266 -VEKAREL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 51/285 (18%)
PP2C_C 284..352 CDD:285117 6/17 (35%)
figNP_651724.1 PP2Cc 68..306 CDD:294085 55/285 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.