DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and tab1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_002662286.4 Gene:tab1 / 403084 ZFINID:ZDB-GENE-060628-1 Length:491 Species:Danio rerio


Alignment Length:326 Identity:61/326 - (18%)
Similarity:116/326 - (35%) Gaps:96/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EDSHSAACRLKDPFATWSYF--AVFDGHAGSQISLHCAEHLMSTILESESFSKHKYEAGIREGFL 103
            ||.|..       |:|.|.|  .||:|..||:::....:.|.:.:|..: .|....:|.:|....
Zfish    40 EDGHFR-------FSTESCFLYGVFNGFEGSRVASFVCQCLTAELLLGQ-LSSGDTDADVRRILT 96

  Fly   104 QLDEDMRKLYHD----------------QQG-----------------------GSTAICVFVSP 129
            |..:.:.|.|.:                .:|                       |:|||...:..
Zfish    97 QAFDVVEKSYFETIDDALAEKANLQTQLPEGAYVSAQTHNIADRLKTLEQEVTRGATAIVALILK 161

  Fly   130 DKIYLVNCGDSRAVISR---NGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVS---- 187
            :|:|:.|.|.:||::.:   :|...:..|.....:..|.|..:.|...:...|:..|..:|    
Zfish   162 NKLYIANVGTNRALLCKTTSDGQNQVIQIGRAHTTDNEDELTRLAQLGLDPVRLRQTAVISGQSS 226

  Fly   188 -RAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEH--------DEFIVVACDGIWDVM------ 237
             |..|||..|  .:.:.:|.:.:.:...|:.....|        ..|:::..:|:...:      
Zfish   227 TRRIGDYKVK--FNYTDIDVLSAAKHKPIIAEPEIHGGQSLAGVTGFLLLMSEGLIKALEAAHGP 289

  Fly   238 --TSSEVCEFIRSRLLVTYDLPMIVNSVL--------DI----------CLHKGSRDNMTLLLLL 282
              .:.||...:.:.|.....|.....:|:        |:          |.|   .::||||:.:
Zfish   290 EQVNQEVVAMVAAELAQQGSLEAAAQAVVERVKRLHHDVFVSGRQRAQHCAH---HEDMTLLIRV 351

  Fly   283 L 283
            :
Zfish   352 I 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 57/318 (18%)
PP2C_C 284..352 CDD:285117 61/326 (19%)
tab1XP_002662286.4 PP2Cc 26..327 CDD:238083 54/296 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.