DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Pdp2

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001019777.1 Gene:Pdp2 / 382051 MGIID:1918878 Length:532 Species:Mus musculus


Alignment Length:371 Identity:72/371 - (19%)
Similarity:121/371 - (32%) Gaps:128/371 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FAVFDGHAGSQISLHCAEHL-----------------------MSTILESESFSKH--------- 92
            |.:||||.|...:...:|.|                       |..:|....:.||         
Mouse   140 FGIFDGHGGHACAQAVSERLFYYMAVSLMSHQTLEQMEEATENMKPLLPILRWLKHPGDSIYKDV 204

  Fly    93 ------------------------KYEAGIREGFLQLDED----MRKLYHDQQ----------GG 119
                                    ..|..:...|.:||.|    ::....|:.          .|
Mouse   205 TSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSG 269

  Fly   120 STAICVFVSPDKIYLVNCGDSRAVI---SRNGA--AVISTIDHKPFSPKEQERIQNAGGS----- 174
            :||....|:...:::.|.||.||::   ..|||  .:..|.||..::..|..|::.....     
Mouse   270 ATACMAHVNGVHLHVANAGDCRAILGVQEENGAWSCLPLTCDHNAWNEAELSRLKREHPESEDRT 334

  Fly   175 -VMIKRINGTLAVSRAFGDYDFK-------------NDGSKSPVDQMVSP----------EPDII 215
             ::..|:.|.|...|||||...|             .|.....:.|...|          :|::.
Mouse   335 LIIDDRLLGVLMPCRAFGDVQLKWSKELQRNVLARGFDTEALNIYQFTPPHYYTPPYLTAKPEVT 399

  Fly   216 VCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRD----NM 276
            .......|:|:|:|.||:||::.:.:|             :.::|..:..:..||...|    |:
Mouse   400 YHRLRRQDKFLVLASDGLWDMLGNEDV-------------VRLVVGHLSKVGRHKPDLDQRPANL 451

  Fly   277 TLLLLLLPGAPKVDMDAVKAERSLDQ-TIVQITKEVIEKHEIHDFE 321
            .|:..||.......:.|.      || |...:.:..|..:|..:.|
Mouse   452 GLMQSLLLQRKASGLHAA------DQNTATHLIRHAIGSNEYGEME 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 62/324 (19%)
PP2C_C 284..352 CDD:285117 7/39 (18%)
Pdp2NP_001019777.1 PP2Cc 112..520 CDD:238083 72/371 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.