DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Pdp1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001277316.1 Gene:Pdp1 / 381511 MGIID:2685870 Length:578 Species:Mus musculus


Alignment Length:333 Identity:81/333 - (24%)
Similarity:118/333 - (35%) Gaps:121/333 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VSSMQGW-------RLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLM------- 80
            |||:.|:       ...:||..|||..|:   .......|||||||...|...:|.|.       
Mouse   146 VSSILGFDSNQLPANAPIEDRRSAATCLQ---TRGMLLGVFDGHAGCACSQAVSERLFYYIAVSL 207

  Fly    81 ---STILESES---------------------FSKHK---YEAGIR------------------- 99
               .|:||.|:                     |||..   |...:|                   
Mouse   208 LPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESADIDV 272

  Fly   100 -----EGFLQLDEDMRKLYHDQQG----------------GSTAICVFVSPDKIYLVNCGDSRAV 143
                 ..|.:||.|:.  ...|.|                |:||....|....:::.|.|||||:
Mouse   273 KEALINAFKRLDNDIS--LEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAM 335

  Fly   144 I---SRNG--AAVISTIDHKPFSPKEQERI-----QNAGGSVMIK-RINGTLAVSRAFGDYDFK- 196
            :   ..:|  :||..:.||...:.:|.||:     :|...||:.: |:.|.|...|||||..|| 
Mouse   336 LGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKW 400

  Fly   197 ----------------NDGSKS---PVDQMVSP----EPDIIVCNRSEHDEFIVVACDGIWDVMT 238
                            ||...:   |.:....|    ||::........|:|:|:|.||:|:.|.
Mouse   401 SIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGLWETMH 465

  Fly   239 SSEVCEFI 246
            ..:|...:
Mouse   466 RQDVVRIV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 81/333 (24%)
PP2C_C 284..352 CDD:285117
Pdp1NP_001277316.1 PP2Cc 149..565 CDD:238083 78/330 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.