DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and CG10376

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:270 Identity:76/270 - (28%)
Similarity:128/270 - (47%) Gaps:46/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EMEDSHSAACRLKDPFA--------TWSYFAVFDGHAGSQISLHCAEHLMSTILES-------ES 88
            :|||    .|...|.|.        |..:|.|||||:||..:.:....|...:.:.       .:
  Fly   171 KMED----RCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAA 231

  Fly    89 FSKHKYEAGIREGFLQLDE--DMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAV 151
            ||...|.......||..||  ..:|:    ..|:|::|..::.|::|:...|||:|::......:
  Fly   232 FSPDFYRNAFESAFLLADERFTQKKI----TSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQL 292

  Fly   152 ISTIDHKPFSPKEQERIQNAGGSVMIK----RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEP 212
            .....|||.:|.|::||:.|||:|:..    |:||.|.|:|:.|||..          :.|..||
  Fly   293 QLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL----------EAVIAEP 347

  Fly   213 DIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTY----DLPMIVNSVLDICLHKGSR 273
            |.:....:|..:|:|:..||:||.:..|.:.|.:...|..|.    |:|.:   :::....:.|:
  Fly   348 DFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKL---LIEAAKERDSQ 409

  Fly   274 DNMTLLLLLL 283
            ||:|.:::||
  Fly   410 DNITAVVVLL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 73/262 (28%)
PP2C_C 284..352 CDD:285117 76/270 (28%)
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 74/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.