Sequence 1: | NP_651472.2 | Gene: | CG6036 / 43185 | FlyBaseID: | FBgn0039421 | Length: | 371 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_796216.2 | Gene: | Pptc7 / 320717 | MGIID: | 2444593 | Length: | 310 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 38/201 - (18%) |
---|---|---|---|
Similarity: | 71/201 - (35%) | Gaps: | 72/201 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 GSTAICVFV---SPDKIYLVNCGDSRAVISRNGAAVISTIDHK-----PF----SPKEQERIQNA 171
Fly 172 GGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDV 236
Fly 237 MTSSEVCEFIRSRLLVTYD-LPMIVNSVLD-----------------------ICLHKGSRDNMT 277
Fly 278 LLLLLL 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6036 | NP_651472.2 | PP2Cc | 27..277 | CDD:238083 | 35/193 (18%) |
PP2C_C | 284..352 | CDD:285117 | 38/201 (19%) | ||
Pptc7 | NP_796216.2 | PP2Cc | 66..302 | CDD:381813 | 36/196 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |