DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1e

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_796141.2 Gene:Ppm1e / 320472 MGIID:2444096 Length:749 Species:Mus musculus


Alignment Length:280 Identity:76/280 - (27%)
Similarity:131/280 - (46%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VSSMQGWRLEMEDSHSAAC--------RLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILES 86
            :.:::..|.:|||.|  .|        .|:|. ...:||||||||.|...:::.:.||...::..
Mouse   231 IHAIKNMRRKMEDKH--VCIPDFNMLFNLEDQ-EEQAYFAVFDGHGGVDAAIYASVHLHVNLVRQ 292

  Fly    87 ESFSKHKYEAGIR------EGFLQ--LDEDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAV 143
            |.|.....||..|      |.|:|  ..|.:|       .|:|.:..|:..:.:::...|||:.:
Mouse   293 EMFPHDPAEALCRAFRVTDERFVQKAARESLR-------CGTTGVVTFIRGNMLHVAWVGDSQVM 350

  Fly   144 ISRNGAAVISTIDHKPFSPKEQERIQNAGGSVM---IKRINGTLAVSRAFGDYDFK------NDG 199
            :.|.|.||.....|||....|::||:..||.|:   ..|:||:|:||||.||.:.|      .|.
Mouse   351 LVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVSRAIGDAEHKPYICGDADS 415

  Fly   200 SKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTY-DLPMIVNSV 263
            :.:.:|..               ::::::||||.:|.:...|..:.:...|.... |..|:.:.:
Mouse   416 ASTVLDGT---------------EDYLILACDGFYDTVNPDEAVKVVSDHLKENNGDSSMVAHKL 465

  Fly   264 LDICLHKGSRDNMTLLLLLL 283
            :......||.||:|::::.|
Mouse   466 VASARDAGSSDNITVIVVFL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 74/272 (27%)
PP2C_C 284..352 CDD:285117 76/280 (27%)
Ppm1eNP_796141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..128
7 X 2 AA tandem repeats of P-E 31..44
PP2Cc 227..485 CDD:238083 75/278 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..537
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 608..627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.