DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1h

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001103688.1 Gene:Ppm1h / 319468 MGIID:2442087 Length:513 Species:Mus musculus


Alignment Length:398 Identity:90/398 - (22%)
Similarity:138/398 - (34%) Gaps:159/398 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRL-EMEDSHSAACRLKDPFATWSYFAVFDGHA 67
            |.|.....|....:.:....||        :|.:| |..:|...:|.         |:::|||||
Mouse   106 KAGTITSTPNRNSKRRSSLPNG--------EGLQLKENSESEGISCH---------YWSLFDGHA 153

  Fly    68 GSQISL--------HCAEHLM--------STIL-------ESESFSKH----------------- 92
            ||..::        |..:.|.        |.||       |.||...|                 
Mouse   154 GSGAAVVASRLLQHHITQQLQDIVEILKNSAILPPTCLGEEPESTPAHGRTLTRAASLRGGVGAP 218

  Fly    93 ------------------------KYEAGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDKIY 133
                                    ..|:..:|..||::.: |..| :..||.||:.|.....|:|
Mouse   219 GSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERE-RSAY-NISGGCTALIVVCLLGKLY 281

  Fly   134 LVNCGDSRAVISRNGAAVISTIDHKPFSPK-EQERIQNAG------------------------- 172
            :.|.|||||:|.|||..:..:.:   |:|: |::|:|...                         
Mouse   282 VANAGDSRAIIIRNGEIIPMSSE---FTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKEL 343

  Fly   173 GSVMI------------------------------KRINGTLAVSRAFGDYDFKNDGSKSPVDQM 207
            |..|:                              .|:..|:.|:|..||:|.|...|...:...
Mouse   344 GKKMLYRDFNMTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPF 408

  Fly   208 VSPEPDIIV--CNRSEH--DEFIVVACDGIWDVMTSSEVCEFIRSRL------------LVTYDL 256
            :|..|::.|  .:|.||  |:.:::|.||:|||:::.||.|.|...|            |...||
Mouse   409 LSSAPEVRVYDLSRYEHGADDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDL 473

  Fly   257 PMIVNSVL 264
            .|....||
Mouse   474 VMRARGVL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 85/375 (23%)
PP2C_C 284..352 CDD:285117
Ppm1hNP_001103688.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..133 4/31 (13%)
PP2Cc 142..506 CDD:238083 81/354 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.