DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Pdp

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster


Alignment Length:412 Identity:89/412 - (21%)
Similarity:142/412 - (34%) Gaps:162/412 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EDSHSAACRL-KDPFATWSYFAVFDGHAGSQISLHCAEHLMSTI-----------------LESE 87
            |||.:.|..| ::.|..    .:||||||:......::.|:..:                 .:|:
  Fly    73 EDSRTEASFLHRNGFIC----GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQ 133

  Fly    88 SFSK-HK------------YEAG-------------------IREGFLQLDE----------DMR 110
            ||.| |.            |||.                   :...||||||          |:|
  Fly   134 SFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVR 198

  Fly   111 KLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVIS----------------RNGAAVISTI---- 155
            .: :....|:.|..|.:...::::.:.||..||:.                .:.|..:|.:    
  Fly   199 TM-NVALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRIL 262

  Fly   156 -DHKPFSPKEQER--IQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSP------- 210
             :|    |||:..  |:|.       |:...||..|||||:.:|  .|:..:.|.|.|       
  Fly   263 AEH----PKEEHETVIRNG-------RLLSQLAPLRAFGDFRYK--WSQEIMQQKVLPMFGVQAM 314

  Fly   211 ------------EPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVC----EFIRSRLL-------- 251
                        .||:.......:|:|:|:|.||:||.:..|||.    |.|.|:.:        
  Fly   315 APNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPE 379

  Fly   252 -------VTYDL----------PMIVNSVLDICLHK------GSRDNMTLLLLLLPGAPKVDMDA 293
                   ::..|          |:..|:...:..|.      |...:.....|.||      .||
  Fly   380 GDTTLQEISQQLAER
KAGLTRKPVDQNAATHLIRHALGGTDYGIEHSKISYYLTLP------RDA 438

  Fly   294 VKAER-SLDQTIVQITKEVIEK 314
            |:..| .:..|::....|.|.|
  Fly   439 VRLYRDDITITVIYFNSEHIAK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 78/372 (21%)
PP2C_C 284..352 CDD:285117 9/32 (28%)
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 74/338 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.