DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and CG15035

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_572396.1 Gene:CG15035 / 31673 FlyBaseID:FBgn0029949 Length:374 Species:Drosophila melanogaster


Alignment Length:379 Identity:76/379 - (20%)
Similarity:115/379 - (30%) Gaps:145/379 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HKMGGFLEK------PETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSY-- 59
            ||.|..|.:      ||. .|..|..|||   .:|..|..||             ||..:..|  
  Fly    36 HKGGQVLNRLKGASFPEL-AQNSENIGNG---SMSENQNQRL-------------DPMTSAQYTT 83

  Fly    60 --FAVFDGHAG-------------SQISLHCA---------EHLMSTILESESFSKHKYEA---G 97
              |..|||...             ..:|:.|.         |:......|...|.....:|   |
  Fly    84 LGFGNFDGEGDYLRQKNKINIQLPRLVSVTCGFAKDHIRYPEYNRGKFGEDAWFMSSSPQACIMG 148

  Fly    98 IREGF--------------LQLDEDMRKLYH---------------------DQQ---GGSTAIC 124
            :.:|.              :.|.....::.|                     ||:   .||...|
  Fly   149 VADGVGGWRNYGVDPGKFSMTLMRSCERMSHAPDFKPNRPEILLERAYFDLLDQKCPIVGSCTAC 213

  Fly   125 VFV---SPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAV 186
            :..   ....:|..|.|||..::.|:|..|..:        :||:...|....         ||.
  Fly   214 ILALKRDDSTLYAANIGDSGFLVVRSGKVVCRS--------QEQQHQFNTPYQ---------LAS 261

  Fly   187 SRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFI--RSR 249
            .....|:|..:||.:| .|.:..|         .:..:.|::|.||::|.:..|.:.|.:  .|.
  Fly   262 PPPGYDFDAVSDGPES-ADTIQFP---------MQLGDVILLATDGVYDNVPESFLVEVLTEMSG 316

  Fly   250 LLVTYDLPMIVNSVL-----------------------DICLHKGSRDNMTLLL 280
            :.....|.|..|:|.                       ||....|..|::|:||
  Fly   317 ISNPVRLQMAANTVALMARTLSFSPKHDSPFSQNARKHDIDAWGGKPDDITVLL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 62/344 (18%)
PP2C_C 284..352 CDD:285117
CG15035NP_572396.1 PP2Cc 133..371 CDD:294085 51/265 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.