DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Pp2d1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_038939402.1 Gene:Pp2d1 / 316157 RGDID:1564811 Length:651 Species:Rattus norvegicus


Alignment Length:312 Identity:61/312 - (19%)
Similarity:110/312 - (35%) Gaps:102/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAG----------------SQISL 73
            |:..|.:|...|:.|.....:......|. |...:|.:||.|.|                .|:|:
  Rat   200 GIAICSNSNSTWKAEPNCKFTVVNDFGDK-ANVCFFGLFDSHHGYAAADLASKEFQVLLLHQLSV 263

  Fly    74 HCAEHLMS-----------TIL------ESESFS---------KHKYE---AGIREGFLQLDEDM 109
            ....:.|:           |:.      ..|:||         |.:||   ....:.|.::|..:
  Rat   264 QDPSYQMTAEQQDLINSFHTVFREEYRAREEAFSSTYKTFRTNKREYEDVHKAFAKAFWRMDRLL 328

  Fly   110 RKLYHDQ------QGGSTAICVFVSPDK-------------------------------IYLVNC 137
            | |..::      .|.|...|:.....|                               :::.|.
  Rat   329 R-LGRNEVSRVRWSGCSALTCILEGGIKNPQATKDWEKTYQHGVNSSPFQKIPQIISGVLHIANA 392

  Fly   138 GDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKR------INGTLAVSRAFGDY-DF 195
            |:.:||:.|||.....|.:|...:.||:.|:..:  .|.|..      ::|.:..:|..|.: :.
  Rat   393 GNVQAVLCRNGKGFCLTKEHTTRNTKERRRVLYS--EVGISSDDPYGLLDGHIKTTRGLGFHGNL 455

  Fly   196 KNDGSKSPVDQMVS-PEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFI 246
            :...:..||.|.:| |..|:  |      :|:::|.:|:|.|:...||...:
  Rat   456 RLKKAIIPVPQTISVPIDDL--C------QFLILATNGLWQVLDKKEVTALV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 60/310 (19%)
PP2C_C 284..352 CDD:285117
Pp2d1XP_038939402.1 PP2Cc 214..499 CDD:238083 57/296 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.