DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Pp2C1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster


Alignment Length:427 Identity:107/427 - (25%)
Similarity:176/427 - (41%) Gaps:106/427 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFA---TWSYFAVFDGHAGSQISLHCAEHLMSTIL 84
            |..:|......||.|..|||..|.|.: :.|..   .:::|.::|||.|.:.:|...||||..|:
  Fly   253 GVNMRVTGQCCQGGRKYMEDQFSVAYQ-ESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIV 316

  Fly    85 ESESFSKHKYE---AGIREGFLQLDEDMRKLYHDQQ------------GGSTAICVFVSPDKIYL 134
            :.:.|...:.|   ..||||::.....|   :.:|:            .|:||...|:..:|||:
  Fly   317 KQKQFWSDQDEDVLRAIREGYIATHFAM---WREQEKWPRTANGHLSTAGTTATVAFMRREKIYI 378

  Fly   135 VNCGDSRAVI------SRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGT---------- 183
            .:.|||..|:      .||..|...|.||||.|..|:.|||.:||:|.||  :|.          
  Fly   379 GHVGDSGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIK--SGVPRVVWNRPRD 441

  Fly   184 ------------------LAVSRAFGDYDFKNDGSKSPVDQMVSPEPD--IIVCNRSEHDEFIVV 228
                              |||:|:.||....|...|   :.:|||:||  ::..|.|.. ..::.
  Fly   442 PMHRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFK---EFVVSPDPDVKVVKINPSTF-RCLIF 502

  Fly   229 ACDGIWDVMTSSEVCEFIRSRLLVTYDL---------PMIVNSVLDICLHKGSR-DNMTLLLLLL 283
            ..||:|:|:|:.|..:.:|...|:...|         ..:|:..|.....|..| ||.:::.::|
  Fly   503 GTDGLWNVVTAQEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVIL 567

  Fly   284 --------PGAPKVDMDAVKAERSLDQTIVQITKEVIEKHEIHDFETLIRLMKRMAINIPNLPPG 340
                    |..|.....|:..:..|:       .|::.:.:..:..||         ::.|..|.
  Fly   568 TPAARNNSPTTPTRSPSAMARDNDLE-------VELLLEEDDEELPTL---------DVENNYPD 616

  Fly   341 GGLYAKYYIIEQAF------HEKFPDTPAEIYDYFSM 371
            ..:....|:::|.:      |.  |......:|||.:
  Fly   617 FLIEEHEYVLDQPYSALAKRHS--PPEAFRNFDYFDV 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 89/313 (28%)
PP2C_C 284..352 CDD:285117 10/67 (15%)
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 89/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47992
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.