DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1k

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001101333.1 Gene:Ppm1k / 312381 RGDID:1308501 Length:372 Species:Rattus norvegicus


Alignment Length:266 Identity:77/266 - (28%)
Similarity:123/266 - (46%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHL---MSTILESESFSKH 92
            :|:.|.|.|.||....|...::..    ||||:|||.|...:..|..|:   ::.:|..|.    
  Rat    98 ASLIGKRKENEDRFGFAQLTEEVL----YFAVYDGHGGPAAADFCHTHMEKCVTDLLPREK---- 154

  Fly    93 KYEAGIREGFLQLDEDMRKLYHDQQGGS-----TAICVFVSPDKIYLV--NCGDSRAVISRNGAA 150
            ..|..:...||::|:......|.....|     |...|.:..|.:.||  :.|||||::.|.|..
  Rat   155 DLETVLTLAFLEIDKAFSSYAHLSADASLLTSGTTATVALLRDGVELVVASVGDSRALLCRKGKP 219

  Fly   151 VISTIDHKPFSPKEQERIQNAGG-----SVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSP 210
            :..|.||.|....|:|||:..||     |:....:||.||::|:.||.|.|..|      .:..|
  Rat   220 MKLTTDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKASG------VIAEP 278

  Fly   211 EPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDN 275
            |...|....:: |.|:|:..|||..::.|.|:|:|:..    .:|.....::|.:..:..|:.||
  Rat   279 ETTRIKLYHAD-DSFLVLTTDGINFMVNSQEICDFVNQ----CHDPKEAAHAVTEQAIQYGTEDN 338

  Fly   276 MTLLLL 281
            .|.:::
  Rat   339 STAVVV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 76/260 (29%)
PP2C_C 284..352 CDD:285117
Ppm1kNP_001101333.1 PP2Cc 95..346 CDD:238083 77/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.