DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1l

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001101151.1 Gene:Ppm1l / 310506 RGDID:1305220 Length:360 Species:Rattus norvegicus


Alignment Length:312 Identity:91/312 - (29%)
Similarity:155/312 - (49%) Gaps:49/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMGGF--LEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKD---PFATWSYFAVF 63
            ::||.  ||...::....:.|    ...|.|:||.|..|||.......|.:   |    |.|.:|
  Rat    71 RLGGLDVLEAEFSKTWEFKSH----NVAVYSIQGRRDHMEDRFEVLTDLANKTHP----SIFGIF 127

  Fly    64 DGHAGSQISLHCAEHLMSTILES-----ESFSKHK------YEAGIREGFLQLDEDMRK---LYH 114
            |||.|..    .||::.|.:.|:     :.:.|.|      |:..:.:..|.:|.:|.:   :.:
  Rat   128 DGHGGET----AAEYVKSRLPEALKQHLQDYEKDKENSVLTYQTILEQQILSIDREMLEKLTVSY 188

  Fly   115 DQQGGSTAICVFVSPDKIYLVNCGDSRAVI-SRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIK 178
            | :.|:|.:...:|...:.:.|.||||.|: .::|.|:..:.||||:..||::||:.|||.:...
  Rat   189 D-EAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFN 252

  Fly   179 ---RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSE-HDEFIVVACDGIWDVMTS 239
               |:.|.||:||:.|||..||       ..:|.|:|||:..:..: ..||:::|.||:||..::
  Rat   253 GSWRVQGILAMSRSLGDYPLKN-------LNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSN 310

  Fly   240 SEVCEFIRSRLLVTYDLPMI-VNSVLDICLHKGSRDNMTLLLLLLPGAPKVD 290
            .|...||:.||    |.|.. ..|::....::|..||:|::::....:.|.:
  Rat   311 EEAVRFIKERL----DEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 84/272 (31%)
PP2C_C 284..352 CDD:285117 1/7 (14%)
Ppm1lNP_001101151.1 PP2Cc 93..351 CDD:238083 85/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.