DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Pptc7

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:201 Identity:38/201 - (18%)
Similarity:71/201 - (35%) Gaps:72/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GSTAICVFV---SPDKIYLVNCGDSRAVISRNGAAVISTIDHK-----PF----SPKEQERIQNA 171
            ||:..|:.|   |..:::..|.|||..::.|.|..|..:.:.:     ||    :|.|.|     
  Rat   138 GSSTACIVVLDRSSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAE----- 197

  Fly   172 GGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDV 236
             |.|:                       |.|| |...|...|:      :..:.|:.|.||::|.
  Rat   198 -GVVL-----------------------SDSP-DAADSTSFDV------QLGDIILTATDGLFDN 231

  Fly   237 MTSSEVCEFIRSRLLVTYD-LPMIVNSVLD-----------------------ICLHKGSRDNMT 277
            |....:.:.::......|: :.....|:.:                       :.:..|..|::|
  Rat   232 MPDYMILQELKKLKNSNYESIQRTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDIT 296

  Fly   278 LLLLLL 283
            :||.::
  Rat   297 VLLSIV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 35/193 (18%)
PP2C_C 284..352 CDD:285117 38/201 (19%)
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 36/196 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.