DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1n

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_038959919.1 Gene:Ppm1n / 292690 RGDID:1562091 Length:409 Species:Rattus norvegicus


Alignment Length:296 Identity:118/296 - (39%)
Similarity:180/296 - (60%) Gaps:11/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QEGHG-----NGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEH 78
            |..||     :|||:..|::||||..|||:|.|...|....:.|::|||.|||.|::.:...|.|
  Rat    46 QRLHGGAAAASGLRFGASAVQGWRARMEDAHCAQLALPGLPSGWAFFAVLDGHGGARAARFGARH 110

  Fly    79 LMSTILESESFSKHKYEAGIRE----GFLQLDEDMRKLY-HDQQGGSTAICVFVSPDKIYLVNCG 138
            |...:| .|.....:...|:|:    .||..|..:.||: ....|||||:.:.|||..:||.:||
  Rat   111 LPGHVL-GELGPAPREPDGVRQALRSAFLHADSQLSKLWPRCDPGGSTAVALLVSPRFLYLAHCG 174

  Fly   139 DSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSP 203
            ||||::||:|:....|.||:|..|:|:|||.:|||:|..:|:.|:||||||.||:.:|....:.|
  Rat   175 DSRALLSRSGSVAFCTEDHRPHRPRERERIHDAGGTVRRRRVEGSLAVSRALGDFAYKQAPGRPP 239

  Fly   204 VDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICL 268
            ..|:||.||::....|.:.|||:::|.||:||.::.:::...:.|||.:..|..::...:||.||
  Rat   240 ELQLVSAEPEVAALARQDEDEFVLLASDGVWDALSGADLAGLVTSRLRLGLDPELLCAQLLDTCL 304

  Fly   269 HKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQTI 304
            .|||.||||.:::..||||:...:|:..|.:||..:
  Rat   305 CKGSLDNMTCMVVCFPGAPRPCEEAISKEMALDAVL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 103/254 (41%)
PP2C_C 284..352 CDD:285117 8/21 (38%)
Ppm1nXP_038959919.1 PP2Cc 59..319 CDD:238083 105/260 (40%)
PP2C_C 313..>345 CDD:421906 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X444
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.