DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1f

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_786931.1 Gene:Ppm1f / 287931 RGDID:631363 Length:450 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:131/271 - (48%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VSSMQGWRLEMEDSHSAACRLKDPFAT-----WSYFAVFDGHAGSQISLHCAEHLMSTILESESF 89
            :.:::..|.:|||.|.:.......|..     .:||||||||.|...:.:.:.|:.:.       
  Rat   155 IHAIRNTRRKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHVHTN------- 212

  Fly    90 SKHKYE------AGIREGFLQLDE-DMRKLYHDQ-QGGSTAICVFVSPDKIYLVNCGDSRAVISR 146
            :.|:.|      |.::|.|...|: .::|...:: |.|:|.:|..::...:::...|||:.::.:
  Rat   213 ASHQPELLTDPAAALKEAFRHTDQMFLQKAKRERLQSGTTGVCALITGAALHVAWLGDSQVILVQ 277

  Fly   147 NGAAVISTIDHKPFSPKEQERIQNAGGSVMIK---RINGTLAVSRAFGDYDFKNDGSKSPVDQMV 208
            .|..|.....|||....|:.||:..||.|.:.   |:|||||||||.||...|         ..|
  Rat   278 QGQVVKLMEPHKPERQDEKSRIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQK---------PYV 333

  Fly   209 SPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPM-IVNSVLDICLHKGS 272
            |.|.|......:..::::::||||.:||:...|:...:...||......| :...::.:...:||
  Rat   334 SGEADAASRELTGLEDYLLLACDGFFDVVPHHEIPGLVHGHLLRQKGSGMHVAEELVAVARDRGS 398

  Fly   273 RDNMTLLLLLL 283
            .||:|::::.|
  Rat   399 HDNITVMVVFL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 72/263 (27%)
PP2C_C 284..352 CDD:285117 74/271 (27%)
Ppm1fNP_786931.1 PP2C 151..402 CDD:395385 71/262 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.