DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1d

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001099295.2 Gene:Ppm1d / 287585 RGDID:1305460 Length:598 Species:Rattus norvegicus


Alignment Length:388 Identity:104/388 - (26%)
Similarity:160/388 - (41%) Gaps:93/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKH---KYEAGIREGFLQLDEDM 109
            ||.:...|   :|||.|||.|.:.:....|||...|.:.:.|:..   |..|.||:|||.....|
  Rat    85 CRRRSSVA---FFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAM 146

  Fly   110 RKLYHD---------QQGGSTAICVFVSPDKIYLVNCGDSRAVISRNG-------AAVISTIDHK 158
            .|...:         ...|:||..|.:...|:|:.:.|||..|:....       .||..|.|||
  Rat   147 WKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHK 211

  Fly   159 PFSPKEQERIQNAGGSVMIK-----------RINGT--------------LAVSRAFGD---YDF 195
            |..|||:|||:..|||||.|           |:..:              |||:||.||   |||
  Rat   212 PELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHSGPVRRSTVIDQIPFLAVARALGDLWSYDF 276

  Fly   196 KNDGSKSPVDQMVSPEPDIIV--CNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDL-- 256
            .:.      ..:||||||..|  .:..:| ::|::..||:|:::...:.....:.:....|.:  
  Rat   277 FSG------KFVVSPEPDTSVHTLDPQKH-KYIILGSDGLWNMVPPQDAISMCQDQEEKKYLMGE 334

  Fly   257 ------PMIVNSVLDICLHKGSR-DNMTLLLLLLPGAPKVDMDAVKAERSLDQTIVQITKEVIEK 314
                  .|:||..|.....:..| ||.:.:::.:  :|:||........  |:..:.:|    :.
  Rat   335 QGQSCAKMLVNRALGRWRQRMLRADNT
SAIVICI--SPEVDNQGNFTNE--DELFLNLT----DS 391

  Fly   315 HEIHDFETLIRLMKRMAINIPNLPPGGGL------------YAKYYIIEQAFHEKFPDTPAEI 365
            ...:..||.:     |..:..:.||...|            :....:...||.|||.:.||||
  Rat   392 PTYNSQETCV-----MTPSPSSTPPVKSLEEDPWPRLNSKDHIPALVRSNAFSEKFLEVPAEI 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 84/286 (29%)
PP2C_C 284..352 CDD:285117 11/79 (14%)
Ppm1dNP_001099295.2 PP2C 84..361 CDD:278884 83/285 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.