DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ptc1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_588401.1 Gene:ptc1 / 2539495 PomBaseID:SPCC4F11.02 Length:347 Species:Schizosaccharomyces pombe


Alignment Length:287 Identity:90/287 - (31%)
Similarity:135/287 - (47%) Gaps:63/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QGWRLEMEDSHSAAC------RLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKH 92
            |.||..|||:|  .|      ...|.|.     ||:|||||.|.|.:|.::|...:||.......
pombe    80 QRWRRSMEDTH--ICLYDFGGNQDDGFV-----AVYDGHAGIQASDYCQKNLHKVLLEKVRNEPD 137

  Fly    93 KYEAGIR-EGFLQLDEDMRKLYHDQQGGSTAICVFVSPDK------IYLVNCGDSRAVISRNGAA 150
            :....:. |.|::::..:.|..|:...|.||...|...:|      :|..|.||:|.|:.|:|.|
pombe   138 RLVTDLMDETFVEVNSKIAKATHNDICGCTAAVAFFRYEKNRTRRVLYTANAGDARIVLCRDGKA 202

  Fly   151 VISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEP--- 212
            :..:.|||.....|..|:...||.::..||||.|||:||.||...|         ::||..|   
pombe   203 IRLSYDHKGSDANESRRVTQLGGLMVQNRINGVLAVTRALGDTYLK---------ELVSAHPFTT 258

  Fly   213 DIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRS---------RLLVTYDLPMIVNSVLDICL 268
            :..:.|  .||||.::||||:|||::..|..:|:|:         ||             ::..|
pombe   259 ETRIWN--GHDEFFIIACDGLWDVVSDQEAVDFVRNFVSPREAAVRL-------------VEFAL 308

  Fly   269 HKGSRDNMTLLLLLL---PGAPKVDMD 292
            .:.|.||:|.:::.|   ||    |:|
pombe   309 KRLSTDNITCIVV
NLTRNPG----DLD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 84/267 (31%)
PP2C_C 284..352 CDD:285117 4/9 (44%)
ptc1NP_588401.1 PP2Cc 66..321 CDD:214625 85/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.